Skip to content

Microsoft Visual Studio vs WhiteStarUML

A side-by-side look at Microsoft Visual Studio and WhiteStarUML. For an in-depth review of either product, follow the links below.

Microsoft Visual Studio

Microsoft Visual Studio

Development

Microsoft Visual Studio is an integrated development environment (IDE) from Microsoft for building applications on Windows, web, and cloud platforms. It supports multiple programming languages and allows developers to code, debug, test, and deploy software all in one tool.

ccvisual-basicfpythonjavascripttypescriptsql-servernetaspnetwindows-formswpfuwpxamarin
WhiteStarUML

WhiteStarUML

Development

WhiteStarUML is an open-source UML modeling tool for Windows, Linux and Mac. It allows users to create UML diagrams like class, sequence, use case, state machine and activity diagrams. It has basic UML 2.0 compliance and is lightweight and easy to use.

umlmodelingdiagramsopensource