Skip to content

.co.vu vs Adventure Gamers

A side-by-side look at .co.vu and Adventure Gamers. For an in-depth review of either product, follow the links below.

.co.vu

.co.vu

Online Services

.co.vu is a free website and domain name from Vu. It allows users to create a basic website or blog with a .co.vu domain name. The service is fairly limited in features but easy to use.

freewebsitebloghostingbasiceasy-to-use
Adventure Gamers

Adventure Gamers

Games

Adventure Gamers is a website dedicated to adventure games. It features news, reviews, previews, walkthroughs, and interviews related to adventure games across PC, console, and mobile platforms.

adventure-gamesnewsreviewspreviewswalkthroughsinterviews