.co.vu vs BAMP
A side-by-side look at .co.vu and BAMP. For an in-depth review of either product, follow the links below.
.co.vu
Online Services
.co.vu is a free website and domain name from Vu. It allows users to create a basic website or blog with a .co.vu domain name. The service is fairly limited in features but easy to use.
freewebsitebloghostingbasiceasy-to-use
BAMP
Development
BAMP is an all-in-one installer for setting up a local web development environment on Mac OS. It installs Apache, MySQL, PHP and phpMyAdmin. BAMP provides an easy way to get a testing server running without having to manually install each component.
web-serverphpmysqlphpmyadminapachelocal-development