Skip to content

.co.vu vs Battle Brothers

A side-by-side look at .co.vu and Battle Brothers. For an in-depth review of either product, follow the links below.

.co.vu

.co.vu

Online Services

.co.vu is a free website and domain name from Vu. It allows users to create a basic website or blog with a .co.vu domain name. The service is fairly limited in features but easy to use.

freewebsitebloghostingbasiceasy-to-use
Battle Brothers

Battle Brothers

Games

Battle Brothers is a challenging turn-based tactical RPG set in a medieval fantasy world. You take control of a mercenary company leading your men into dangerous battles against brigands, orcs, undead and more.

turnbased-tacticsmedievalfantasymercenariesrpg

Related Comparisons

Jagged Alliance (Series)
Xenonauts (Series)
Space Rangers (Series)