.co.vu vs Castlevania The Lecarde Chronicles
A side-by-side look at .co.vu and Castlevania The Lecarde Chronicles. For an in-depth review of either product, follow the links below.
.co.vu
Online Services
.co.vu is a free website and domain name from Vu. It allows users to create a basic website or blog with a .co.vu domain name. The service is fairly limited in features but easy to use.
freewebsitebloghostingbasiceasy-to-use
Castlevania The Lecarde Chronicles
Games
Castlevania The Lecarde Chronicles is a fan-made freeware Castlevania game made in the style of Castlevania: Symphony of the Night. It features a new protagonist named Loretta Lecarde and includes RPG elements, side quests, unlockable skills, and large explorable areas with secret rooms.
fanmadefreewarecastlevaniasymphony-of-the-nightside-questsunlockable-skillsexplorable-areassecret-rooms
Related Comparisons
Blasphemous
Katana ZERO
Hollow Knight
Dead Cells