Skip to content

.co.vu vs CSV Buddy

A side-by-side look at .co.vu and CSV Buddy. For an in-depth review of either product, follow the links below.

.co.vu

.co.vu

Online Services

.co.vu is a free website and domain name from Vu. It allows users to create a basic website or blog with a .co.vu domain name. The service is fairly limited in features but easy to use.

freewebsitebloghostingbasiceasy-to-use
CSV Buddy

CSV Buddy

Office & Productivity

CSV Buddy is a CSV editing tool that allows you to easily view, edit, filter, merge and split CSV or text files. It has a simple, user-friendly interface for quickly working with CSV data.

csveditingviewingfilteringmergingsplitting

Related Comparisons