.co.vu vs Destroy Windows Spying
A side-by-side look at .co.vu and Destroy Windows Spying. For an in-depth review of either product, follow the links below.
.co.vu
Online Services
.co.vu is a free website and domain name from Vu. It allows users to create a basic website or blog with a .co.vu domain name. The service is fairly limited in features but easy to use.
freewebsitebloghostingbasiceasy-to-use
Destroy Windows Spying
Security & Privacy
Destroy Windows Spying is a free, open-source application for Windows that helps stop spying and telemetry in Windows 10. It disables various tracking services and scheduled tasks.
privacyantispyingtelemetrytracking
Related Comparisons
WindowsSpyBlocker
Spybot Anti-Beacon
Debotnet
Ashampoo AntiSpy for Windows 10
Privacy Repairer