.co.vu vs Extreme Music
A side-by-side look at .co.vu and Extreme Music. For an in-depth review of either product, follow the links below.
.co.vu
Online Services
.co.vu is a free website and domain name from Vu. It allows users to create a basic website or blog with a .co.vu domain name. The service is fairly limited in features but easy to use.
freewebsitebloghostingbasiceasy-to-use
Extreme Music
Audio & Music
Extreme Music is a production music library offering a wide variety of high-quality, royalty-free music for use in films, TV, advertising, and other media projects. With over 300,000 tracks in many genres, it's a top choice for media professionals looking to add great music to their projects on a budget.
royaltyfreehighqualityfilmstvadvertisingmedia-projects
Related Comparisons
Freenom
Epidemic Sound
eoun.com
Dynu Dynamic DNS
ClouDNS.net
NameCoin