.co.vu vs Kinde
A side-by-side look at .co.vu and Kinde. For an in-depth review of either product, follow the links below.
.co.vu
Online Services
.co.vu is a free website and domain name from Vu. It allows users to create a basic website or blog with a .co.vu domain name. The service is fairly limited in features but easy to use.
freewebsitebloghostingbasiceasy-to-use
Kinde
Home & Family
Kinde is a free and open-source app designed to help families privately share photos and videos of young children. It provides fine-grained access controls and encryption to ensure privacy.
photosvideossharingfamilieschildrenprivacyencryption