.co.vu vs UwAmp
A side-by-side look at .co.vu and UwAmp. For an in-depth review of either product, follow the links below.
.co.vu
Online Services
.co.vu is a free website and domain name from Vu. It allows users to create a basic website or blog with a .co.vu domain name. The service is fairly limited in features but easy to use.
freewebsitebloghostingbasiceasy-to-use
UwAmp
Development
UwAmp is a free, open-source web server solution stack package for Windows. It includes Apache, MySQL, and PHP preconfigured to work together seamlessly. Useful for local web development and testing.
web-serverapachemysqlphpstackwindows