Skip to content

.co.vu vs Viral Loops

A side-by-side look at .co.vu and Viral Loops. For an in-depth review of either product, follow the links below.

.co.vu

.co.vu

Online Services

.co.vu is a free website and domain name from Vu. It allows users to create a basic website or blog with a .co.vu domain name. The service is fairly limited in features but easy to use.

freewebsitebloghostingbasiceasy-to-use
Viral Loops

Viral Loops

Business & Commerce

Viral Loops is a referral marketing platform that helps companies build referral programs to acquire new users and customers. It provides tools to create incentives for sharing, track referrals, reward referrers, and analyze referral program performance.

referralmarketinganalyticssharingrewards

Related Comparisons