CSV Buddy vs TopCoder UML
A side-by-side look at CSV Buddy and TopCoder UML. For an in-depth review of either product, follow the links below.
CSV Buddy
Office & Productivity
CSV Buddy is a CSV editing tool that allows you to easily view, edit, filter, merge and split CSV or text files. It has a simple, user-friendly interface for quickly working with CSV data.
csveditingviewingfilteringmergingsplitting
TopCoder UML
Development
TopCoder UML is an open source unified modeling language tool for creating UML diagrams and documentation. It is lightweight, cross-platform, and has features for class, sequence, use case, and other UML diagrams.
umlmodelingdiagramsopen-source
Related Comparisons
CSV Editor Pro
Violet UML Editor
Csv Easy
Software Ideas Modeler
Modelio
CSVboard