Skip to content

CSV Buddy vs Umbrello

A side-by-side look at CSV Buddy and Umbrello. For an in-depth review of either product, follow the links below.

CSV Buddy

CSV Buddy

Office & Productivity

CSV Buddy is a CSV editing tool that allows you to easily view, edit, filter, merge and split CSV or text files. It has a simple, user-friendly interface for quickly working with CSV data.

csveditingviewingfilteringmergingsplitting
Umbrello

Umbrello

Development

Umbrello is an open source Unified Modeling Language (UML) diagramming tool and code generator. It supports UML diagrams like class diagrams, use case diagrams, sequence diagrams, state machine diagrams and more. Umbrello helps developers design and document software applications and systems.

umlmodelingdiagramsopen-source

Related Comparisons

Visual Paradigm
Software Ideas Modeler