Fiverr vs Krop
A side-by-side look at Fiverr and Krop. For an in-depth review of either product, follow the links below.
Fiverr
Online Services
Fiverr is an online marketplace for freelance services. Freelancers offer services starting at $5, and buyers can purchase these gig services for projects or tasks they need completed. Popular services include graphic design, digital marketing, programming, video editing, and more.
freelancinggigsservicesmarketplaceprojectstasks
Krop
Online Services
Krop is an online portfolio platform that allows creative professionals like designers, developers, photographers and more to create an online portfolio to showcase their work. It offers custom domain support, customizable designs, and analytics.
portfoliodesigncreativeshowcase