Fiverr vs tucows
A side-by-side look at Fiverr and tucows. For an in-depth review of either product, follow the links below.
Fiverr
Online Services
Fiverr is an online marketplace for freelance services. Freelancers offer services starting at $5, and buyers can purchase these gig services for projects or tasks they need completed. Popular services include graphic design, digital marketing, programming, video editing, and more.
freelancinggigsservicesmarketplaceprojectstasks
tucows
Online Services
Tucows is a software and mobile services company that provides domain registration, email, and other internet services. It also operates an internet services provider and downloads website.
domainemailinternet-servicesdownloads