Skip to content

Google Cloud DNS vs Patternry

A side-by-side look at Google Cloud DNS and Patternry. For an in-depth review of either product, follow the links below.

Google Cloud DNS

Google Cloud DNS

Network & Admin

Google Cloud DNS is a scalable, reliable and managed authoritative Domain Name System service offered by Google Cloud. It allows you to publish and manage millions of DNS zones and records in a cost-effective way.

dnsdomain-name-systemcloudgoogle-cloudmanaged-service
Patternry

Patternry

Home & Family

Patternry is a pattern making and grading web application for sewing and crafting. It allows users to draft custom patterns from measurements, grade patterns into multiple sizes, print pattern pieces, and share designs.

pattern-makinggradingsewingcrafting