Grace Sampler vs Rack Performer
A side-by-side look at Grace Sampler and Rack Performer. For an in-depth review of either product, follow the links below.
Grace Sampler
Audio & Music
Grace Sampler is a free, open source audio sampler and sequencer application for Windows, macOS, and Linux. It allows users to record and edit audio samples, assemble them into instruments and loops, apply effects, and sequence them to create songs and compositions.
samplersequenceraudio-editingopen-source
Rack Performer
Audio & Music
Rack Performer is a modular virtual instrument plugin that allows you to build custom synths, samplers, and effects units within a rack-style interface. It features over 200 modules to choose from including oscillators, filters, envelopes, sequencers, and more.
modularsynthsamplereffectsrackinstrument
Related Comparisons
Pedalboard 2
Vienna Ensemble Pro
Shortcircuit Sampler
Camelot Pro
Kushview Element
UVI Workstation