Labinator PicoSpace Theme vs Umbrello
A side-by-side look at Labinator PicoSpace Theme and Umbrello. For an in-depth review of either product, follow the links below.
Labinator PicoSpace Theme
Education & Reference
Labinator PicoSpace Theme is a minimalist theme for Labinator websites. It features a clean, whitespace-heavy design with sans-serif typography, intended to put the focus on your content.
thememinimalistcleanwhitespacesansseriftypographyfocuscontent
Umbrello
Development
Umbrello is an open source Unified Modeling Language (UML) diagramming tool and code generator. It supports UML diagrams like class diagrams, use case diagrams, sequence diagrams, state machine diagrams and more. Umbrello helps developers design and document software applications and systems.
umlmodelingdiagramsopen-source
Related Comparisons
Microsoft Office Visio
yEd Graph Editor
UML Designer
Software Ideas Modeler
Papyrus UML