Skip to content

NanoHost vs Rack Performer

A side-by-side look at NanoHost and Rack Performer. For an in-depth review of either product, follow the links below.

NanoHost

NanoHost

Online Services

NanoHost is a lightweight, easy-to-use web hosting provider optimized for individuals and small businesses. It offers affordable shared hosting plans with unlimited bandwidth, free domain registration, one-click WordPress installation, and 24/7 customer support.

hostingweb-hostingshared-hostingsmall-businesswordpress
Rack Performer

Rack Performer

Audio & Music

Rack Performer is a modular virtual instrument plugin that allows you to build custom synths, samplers, and effects units within a rack-style interface. It features over 200 modules to choose from including oscillators, filters, envelopes, sequencers, and more.

modularsynthsamplereffectsrackinstrument

Related Comparisons

Live Guitar and Bass Bundle by Audified
Audified inTone
New Sonic Arts Freestyle