Skip to content

Patternry vs Speedy Route

A side-by-side look at Patternry and Speedy Route. For an in-depth review of either product, follow the links below.

Patternry

Patternry

Home & Family

Patternry is a pattern making and grading web application for sewing and crafting. It allows users to draft custom patterns from measurements, grade patterns into multiple sizes, print pattern pieces, and share designs.

pattern-makinggradingsewingcrafting
Speedy Route

Speedy Route

Business & Commerce

Speedy Route is route optimization software designed to help businesses plan efficient routes and schedules for their fleet of vehicles. It allows users to input addresses and parameters and creates an optimized sequence to reduce miles driven.

routinglogisticsschedulingfleet-management