Skip to content

PlantUML vs Saola Animate

A side-by-side look at PlantUML and Saola Animate. For an in-depth review of either product, follow the links below.

PlantUML

PlantUML

Development

PlantUML is an open-source tool for creating UML diagrams from plain text. It supports all standard UML diagrams like use case diagrams, class diagrams, sequence diagrams, etc. PlantUML allows users to write simple textual descriptions which are then transformed into UML diagrams.

umldiagramsmodeling
Saola Animate

Saola Animate

Development

Saola Animate is a 2D animation software that allows users to create frame-by-frame animations, vector animations, motion graphics, and interactive content. It has an intuitive timeline for keyframing, vector drawing tools, a library of characters and assets, and supports exporting to multiple formats.

2d-animationvector-animationmotion-graphicsinteractive-contenttimelinekeyframingdrawing-toolscharacter-libraryasset-library