Skip to content

FreeDNS vs TinyArrows

A side-by-side look at FreeDNS and TinyArrows. For an in-depth review of either product, follow the links below.

FreeDNS

FreeDNS

Network & Admin

FreeDNS is a free dynamic DNS service that allows you to access your home network using a domain name instead of an IP address. It maps your dynamic IP to a static hostname so you can easily connect to home servers, webcams, etc. from anywhere.

dynamic-dnsddnsdomain-nameip-addresshome-network
TinyArrows

TinyArrows

Office & Productivity

TinyArrows is a simple, open-source diagramming and flowchart software. It allows users to easily create flowcharts, UML diagrams, mind maps, wireframes, and more. With an intuitive drag-and-drop interface, SVG support for sharp images, and native cross-platform apps, TinyArrows makes diagramming simple.

flowchartdiagrammind-mapwireframesvg

Related Comparisons