Skip to content

TinyArrows vs YOURLS

A side-by-side look at TinyArrows and YOURLS. For an in-depth review of either product, follow the links below.

TinyArrows

TinyArrows

Office & Productivity

TinyArrows is a simple, open-source diagramming and flowchart software. It allows users to easily create flowcharts, UML diagrams, mind maps, wireframes, and more. With an intuitive drag-and-drop interface, SVG support for sharp images, and native cross-platform apps, TinyArrows makes diagramming simple.

flowchartdiagrammind-mapwireframesvg
YOURLS

YOURLS

Online Services

YOURLS is a free, open source URL shortener that allows you to host your own URL shortening service. It is PHP-based and very lightweight, making it easy to install on shared hosting. With YOURLS, you can customize your own short domain names and have full control over analytics and settings.

url-shortenerlink-shorteneropen-source

Related Comparisons