Skip to content

.co.vu vs Google AdWords

A side-by-side look at .co.vu and Google AdWords. For an in-depth review of either product, follow the links below.

.co.vu

.co.vu

Online Services

.co.vu is a free website and domain name from Vu. It allows users to create a basic website or blog with a .co.vu domain name. The service is fairly limited in features but easy to use.

freewebsitebloghostingbasiceasy-to-use
Google AdWords

Google AdWords

Business & Commerce

Google AdWords is Google's advertising platform that allows businesses to create targeted ads that appear on Google Search and the Google Display Network. It uses a pay-per-click pricing model.

advertisingmarketingpayperclickads