Skip to content

.co.vu vs Rack Performer

A side-by-side look at .co.vu and Rack Performer. For an in-depth review of either product, follow the links below.

.co.vu

.co.vu

Online Services

.co.vu is a free website and domain name from Vu. It allows users to create a basic website or blog with a .co.vu domain name. The service is fairly limited in features but easy to use.

freewebsitebloghostingbasiceasy-to-use
Rack Performer

Rack Performer

Audio & Music

Rack Performer is a modular virtual instrument plugin that allows you to build custom synths, samplers, and effects units within a rack-style interface. It features over 200 modules to choose from including oscillators, filters, envelopes, sequencers, and more.

modularsynthsamplereffectsrackinstrument