Skip to content

Bandwidth Manager vs Patternry

A side-by-side look at Bandwidth Manager and Patternry. For an in-depth review of either product, follow the links below.

Bandwidth Manager

Bandwidth Manager

Network & Admin

Bandwidth Manager is a network monitoring tool that provides visibility into bandwidth usage across an organization's network. It tracks bandwidth usage by IP address, protocol, domain, subnet, interface, and more to identify trends and heavy users.

networkmonitoringbandwidthusagetrends
Patternry

Patternry

Home & Family

Patternry is a pattern making and grading web application for sewing and crafting. It allows users to draft custom patterns from measurements, grade patterns into multiple sizes, print pattern pieces, and share designs.

pattern-makinggradingsewingcrafting