Skip to content

Groovy vs Microsoft Visual Studio

A side-by-side look at Groovy and Microsoft Visual Studio. For an in-depth review of either product, follow the links below.

Groovy

Groovy

Development

Groovy is a powerful, optionally typed and dynamic language, with static-typing and static compilation capabilities, for the Java platform aimed at improving developer productivity thanks to a concise, familiar and easy to learn syntax. It integrates smoothly with any Java program, and immediately delivers to your application powerful features, including scripting capabilities, Domain-Specific Language authoring, runtime and compile-time meta-programming and …

dynamicoptional-typingjava-platformscriptingmetaprogrammingfunctional-programming
Microsoft Visual Studio

Microsoft Visual Studio

Development

Microsoft Visual Studio is an integrated development environment (IDE) from Microsoft for building applications on Windows, web, and cloud platforms. It supports multiple programming languages and allows developers to code, debug, test, and deploy software all in one tool.

ccvisual-basicfpythonjavascripttypescriptsql-servernetaspnetwindows-formswpfuwpxamarin