Skip to content

Klystrack vs Rack Performer

A side-by-side look at Klystrack and Rack Performer. For an in-depth review of either product, follow the links below.

Klystrack

Klystrack

Audio & Music

Klystrack is a free chiptune tracker for Windows, macOS and Linux. It allows users to compose and sequence retro-style video game music using a track-based sequencing interface modeled after classic trackers from the 80s and 90s.

chiptunetrackerretrovideo-game-musicsequencer
Rack Performer

Rack Performer

Audio & Music

Rack Performer is a modular virtual instrument plugin that allows you to build custom synths, samplers, and effects units within a rack-style interface. It features over 200 modules to choose from including oscillators, filters, envelopes, sequencers, and more.

modularsynthsamplereffectsrackinstrument