Skip to content

Patternry vs Project Gutenberg

A side-by-side look at Patternry and Project Gutenberg. For an in-depth review of either product, follow the links below.

Patternry

Patternry

Home & Family

Patternry is a pattern making and grading web application for sewing and crafting. It allows users to draft custom patterns from measurements, grade patterns into multiple sizes, print pattern pieces, and share designs.

pattern-makinggradingsewingcrafting
Project Gutenberg

Project Gutenberg

News & Books

Project Gutenberg is an online library containing over 60,000 free eBooks. The eBooks are available in epub, Kindle, HTML and simple text formats. The library focuses on public domain content.

ebookspublic-domainfree-books