Skip to content

Inkworthy vs Project Gutenberg

A side-by-side look at Inkworthy and Project Gutenberg. For an in-depth review of either product, follow the links below.

Inkworthy

Inkworthy

Ai Tools & Services

Inkworthy is a writing assistant software that helps improve your writing through AI-powered suggestions and feedback. It checks for spelling, grammar, style, and structure issues.

writinggrammarspellingstylefeedback
Project Gutenberg

Project Gutenberg

News & Books

Project Gutenberg is an online library containing over 60,000 free eBooks. The eBooks are available in epub, Kindle, HTML and simple text formats. The library focuses on public domain content.

ebookspublic-domainfree-books